PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca50793.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 523aa    MW: 59400.1 Da    PI: 7.0766
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca50793.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.31.5e-49571822128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                 +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ +  ++ +++
  Dca50793.1  57 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRGENLRQI 154
                 79***************************.89***************888889********************************************** PP

         NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                 glkktLvfy+g+apkg +t+W+m+eyrl
  Dca50793.1 155 GLKKTLVFYSGKAPKGIRTSWIMNEYRL 182
                 **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-5556202IPR003441NAC domain
PROSITE profilePS5100555.2156203IPR003441NAC domain
PfamPF023651.9E-2458182IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MAIATTMNLN TVDITTTTNT STPSNTNTNT EKQQQQEDHQ GDQAATADDE HEHDMVMPGF  60
RFHPTEEELI EFYLRRKVEG KRFNVELITF LDLYRYDPWE LPAMAAIGEK EWFFYVPRDR  120
KYRNGDRPNR VTTSGYWKAT GADRMIRGEN LRQIGLKKTL VFYSGKAPKG IRTSWIMNEY  180
RLPQHETERY QKAEISLCRV YKRAGVEDHQ PTSSRSGIPS RLTSSSFERK NHHSAFRAQS  240
SSLQNHHQHH QIMDKVSETD ASSSTDVGTT LGLSHHNSYT VVSPLATSQS TPPLPPAPAP  300
HHQPPSTLEV DRMMHMLNNN HHQQGDHCGG SSLLLEGRNN SNLMSSTPIF LGNSSSNNTS  360
NNHHHNQYHQ PSLEEIQRLV EYQQSYFNHH FQQQQNQQQH YQQHENRQQQ QQQLQFEALT  420
SHPSTTTTAT TTTATNTNNN NNINNNTNNN SQFLFSNYLF SSPLQQQQQQ PILNNPPPVV  480
GGSIGLSLPV TTAASGGGGG GAPFWEWNPF PDPNRDQFSN LFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-545820322168NAC domain-containing protein 19
3swp_C3e-545820322168NAC domain-containing protein 19
3swp_B3e-545820322168NAC domain-containing protein 19
3swp_A3e-545820322168NAC domain-containing protein 19
3swm_D3e-545820322168NAC domain-containing protein 19
3swm_C3e-545820322168NAC domain-containing protein 19
3swm_B3e-545820322168NAC domain-containing protein 19
3swm_A3e-545820322168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010682089.11e-173PREDICTED: protein CUP-SHAPED COTYLEDON 1
TrEMBLA0A0J8C7481e-173A0A0J8C748_BETVU; Uncharacterized protein
STRINGGLYMA17G00650.21e-126(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-106NAC domain containing protein 35